PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G168400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 791aa    MW: 87918.7 Da    PI: 6.4108
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G168400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2091146156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t+ q++e+e+lF+++++p+ ++r +L++ lgL+ rqVk+WFqNrR+++k
  Aqcoe3G168400.1.p  91 KKRYHRHTARQIQEMEALFKECPHPDDKQRMKLSADLGLKPRQVKFWFQNRRTQMK 146
                        688899***********************************************998 PP

2START158.94.1e-502905143206
                        HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
              START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                        a  a++el+k+ + +ep+W        e++n +e  + f+   +        ++ea r+s+vv+m++ +l   +ld++ +W   ++    +a
  Aqcoe3G168400.1.p 290 AMNAMDELMKMCQMNEPLWIPNNsgtkEMLNMEEHAKMFPWLTNfkqqhsqVRTEATRDSAVVIMNSITLTDAFLDVN-KWMDIFPsiisRA 380
                        6689***************9998777766666665554433222555566889*************************.************* PP

                        EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
              START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                        +t++ issg      g l+lm+aelq+ splvp R+  f+Ry++q  ++g+w+ivd  +ds  +   + s+ R +++pSg+li++++ng+s+
  Aqcoe3G168400.1.p 381 KTVQIISSGiaghasGSLHLMYAELQVQSPLVPtREAHFLRYCQQnAEEGTWAIVDFPIDSFHDSL-QYSFPRYRRRPSGCLIQDMPNGYSR 471
                        **************************************************************9987.9************************ PP

                        EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        vtwveh++++++ +h++++++v+sg+a+ga++w+a lq+qce+
  Aqcoe3G168400.1.p 472 VTWVEHAEVEDKPVHQIFNHFVNSGTAFGAQRWLAVLQQQCER 514
                        *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.38E-1976149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2186155IPR009057Homeodomain-like
PROSITE profilePS5007116.82788148IPR001356Homeobox domain
SMARTSM003894.7E-1989152IPR001356Homeobox domain
CDDcd000861.20E-1791149No hitNo description
PfamPF000465.2E-1891146IPR001356Homeobox domain
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
PROSITE profilePS5084843.593279517IPR002913START domain
SuperFamilySSF559614.21E-32282516No hitNo description
CDDcd088757.39E-117283513No hitNo description
SMARTSM002342.2E-33288514IPR002913START domain
PfamPF018524.3E-42290514IPR002913START domain
SuperFamilySSF559616.32E-16551771No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 791 aa     Download sequence    Send to blast
MYGDCQVLST MGGNVMTSDH HSLFASPIRN PNLNFISNLA YNPFSSIIPK EEARLQIASK  60
EDEIESGSVS GHVEGASADE EQDLEEPKPK KKRYHRHTAR QIQEMEALFK ECPHPDDKQR  120
MKLSADLGLK PRQVKFWFQN RRTQMKAQQD RAENAILRAE NENLKNENFR LQAAIRSITC  180
PNCGGPAILG EMSFDEQNIR IENARLKEEL ERLSCVVSRC GGRPMHALGP PPPLLLPSVD  240
LDMNIYSRHF QEQMGACTDM IPVPSMQENS NFAGSNLIME QDKHMALQFA MNAMDELMKM  300
CQMNEPLWIP NNSGTKEMLN MEEHAKMFPW LTNFKQQHSQ VRTEATRDSA VVIMNSITLT  360
DAFLDVNKWM DIFPSIISRA KTVQIISSGI AGHASGSLHL MYAELQVQSP LVPTREAHFL  420
RYCQQNAEEG TWAIVDFPID SFHDSLQYSF PRYRRRPSGC LIQDMPNGYS RVTWVEHAEV  480
EDKPVHQIFN HFVNSGTAFG AQRWLAVLQQ QCERLASLMA RNISDLGVIP TPEARKNLMK  540
LTQRMIRTFC FNISTAGGQS WTAISDSAED TVRITTRKMT EPGQPSGLIL CAVSTTWLPF  600
SHQQVFDLLR DERRRSQLDV LSSGTSSHEV AHIANGAHPG NCISLLRINA ASNSSQNVEL  660
MLQESSTDQF SSLVVYSTID VDAVQLAMNG EDPSYIPLLP LGFVITPMNN KSGISNSGNT  720
IKSPDNGNGS TSSCSLTVGL QVLASTIPSA KINLSNVTAI NNHIGNVVHQ INAALGGGGS  780
LIEPNLKSEH *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245210.10.0PREDICTED: homeobox-leucine zipper protein ROC3-like isoform X1
RefseqXP_010245211.10.0PREDICTED: homeobox-leucine zipper protein ROC3-like isoform X1
RefseqXP_010245212.10.0PREDICTED: homeobox-leucine zipper protein ROC3-like isoform X1
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA5AJ700.0A5AJ70_VITVI; Putative uncharacterized protein
STRINGVIT_02s0012g02030.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7